Lineage for d1ylfb_ (1ylf B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907312Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 907313Protein automated matches [190154] (14 species)
    not a true protein
  7. 907316Species Bacillus cereus [TaxId:226900] [186878] (1 PDB entry)
  8. 907317Domain d1ylfb_: 1ylf B: [123649]
    Other proteins in same PDB: d1ylfa1
    automated match to d1xd7a_
    complexed with cl

Details for d1ylfb_

PDB Entry: 1ylf (more details), 2.5 Å

PDB Description: x-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.
PDB Compounds: (B:) RRF2 family protein

SCOPe Domain Sequences for d1ylfb_:

Sequence, based on SEQRES records: (download)

>d1ylfb_ a.4.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
ssrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgga
gllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsamee
vlrnitmgqlfetl

Sequence, based on observed residues (ATOM records): (download)

>d1ylfb_ a.4.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
ssrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgga
gllkdlheitlldvyhavnvcpiganiqavleiiliqaqsameevlrnitmgqlfetl

SCOPe Domain Coordinates for d1ylfb_:

Click to download the PDB-style file with coordinates for d1ylfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ylfb_: