Lineage for d1yjww1 (1yjw W:1-154)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178243Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2178244Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2178245Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 protein domains)
  6. 2178246Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 2178247Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 2178266Domain d1yjww1: 1yjw W:1-154 [123487]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1ffkt_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjww1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: Crystal Structure Of Quinupristin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1yjww1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjww1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1yjww1:

Click to download the PDB-style file with coordinates for d1yjww1.
(The format of our PDB-style files is described here.)

Timeline for d1yjww1: