SCOPe 2.08: Domain d1yjwo1: 1yjw O:1-115

Lineage for d1yjwo1 (1yjw O:1-115)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L18e [52084] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
   Uniprot P12733

8. Domain d1yjwo1: 1yjw O:1-115 [123479]
   Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
   automatically matched to d1ffkl_
   complexed with cd, cl, k, mg, mht, na; mutant

Details for d1yjwo1

PDB Entry: 1yjw, 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d1yjwo1:

Sequence; same for both SEQRES and ATOM records:

>d1yjwo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

Timeline for d1yjwo1:

• d1yjwo1 first appeared in SCOP 1.73
  
• d1yjwo1 appears in SCOPe 2.07