Lineage for d1yjw21 (1yjw 2:1-49)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733645Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2733646Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2733647Protein Ribosomal protein L39e [48664] (1 species)
  7. 2733648Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2733696Domain d1yjw21: 1yjw 2:1-49 [144652]
    Other proteins in same PDB: d1yjw11, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, k, mg, mht, na; mutant

Details for d1yjw21

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1yjw21:

Sequence, based on SEQRES records: (download)

>d1yjw21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1yjw21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d1yjw21:

Click to download the PDB-style file with coordinates for d1yjw21.
(The format of our PDB-style files is described here.)

Timeline for d1yjw21: