| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
| Protein 2Fe-2S ferredoxin [54294] (17 species) |
| Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (15 PDB entries) |
| Domain d1yjja1: 1yjj A:1-106 [123422] automatically matched to d1pdxa_ complexed with fes |
PDB Entry: 1yjj (more details)
SCOPe Domain Sequences for d1yjja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjja1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d1yjja1: