SCOPe 2.08: Domain d1yjja_: 1yjj A:

Lineage for d1yjja_ (1yjj A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)

8. Domain d1yjja_: 1yjj A: [123422]
   automated match to d4jwsc_
   complexed with fes

Details for d1yjja_

PDB Entry: 1yjj

PDB Description: rdc-refined solution nmr structure of oxidized putidaredoxin

PDB Compounds: (A:) putidaredoxin

SCOPe Domain Sequences for d1yjja_:

Sequence; same for both SEQRES and ATOM records:

>d1yjja_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw

Timeline for d1yjja_:

• d1yjja_ first appeared in SCOP 1.73, called d1yjja1
  
• d1yjja_ appears in SCOPe 2.07