Lineage for d1yj6a2 (1yj6 A:1-84)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168582Protein Class mu GST [81359] (3 species)
  7. 1168590Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 1168607Domain d1yj6a2: 1yj6 A:1-84 [123386]
    Other proteins in same PDB: d1yj6a1, d1yj6b1, d1yj6c1
    automatically matched to d1gtua2
    complexed with gsh, zn

Details for d1yj6a2

PDB Entry: 1yj6 (more details), 2.5 Å

PDB Description: crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-zinc-trihydroxide
PDB Compounds: (A:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1yj6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj6a2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d1yj6a2:

Click to download the PDB-style file with coordinates for d1yj6a2.
(The format of our PDB-style files is described here.)

Timeline for d1yj6a2: