Lineage for d1yj1a1 (1yj1 A:1-59)

  1. Root: SCOPe 2.07
  2. 2652352Class k: Designed proteins [58788] (44 folds)
  3. 2652972Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 2652973Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 2652974Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 2652975Protein Ubiquitin [144347] (1 species)
  7. 2652976Species Synthetic [144348] (6 PDB entries)
  8. 2652977Domain d1yj1a1: 1yj1 A:1-59 [123377]
    Other proteins in same PDB: d1yj1a2, d1yj1b2, d1yj1c2
    complexed with cd, cl

Details for d1yj1a1

PDB Entry: 1yj1 (more details), 1.3 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d1yj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj1a1 k.45.1.1 (A:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdy

SCOPe Domain Coordinates for d1yj1a1:

Click to download the PDB-style file with coordinates for d1yj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1yj1a1: