SCOPe 2.07: Domain d1yj1b1: 1yj1 B:1-59

Lineage for d1yj1b1 (1yj1 B:1-59)

1. Root: SCOPe 2.07

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.45: Ubiquitin [144344] (1 superfamily)

4. Superfamily k.45.1: Ubiquitin [144345] (1 family)

5. Family k.45.1.1: Ubiquitin [144346] (1 protein)

6. Protein Ubiquitin [144347] (1 species)

7. Species Synthetic [144348] (6 PDB entries)

8. Domain d1yj1b1: 1yj1 B:1-59 [123378]
   Other proteins in same PDB: d1yj1a2, d1yj1b2, d1yj1c2
   automatically matched to 1YJ1 A:1-71
   complexed with cd, cl

Details for d1yj1b1

PDB Entry: 1yj1, 1.3 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1yj1b1:

Sequence; same for both SEQRES and ATOM records:

>d1yj1b1 k.45.1.1 (B:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdy

Timeline for d1yj1b1:

• d1yj1b1 first appeared in SCOP 1.73
  
• d1yj1b1 appears in SCOPe 2.06
  
• d1yj1b1 appears in the current release, SCOPe 2.08