Lineage for d1yijn1 (1yij N:1-186)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887539Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2887540Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2887541Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 2887581Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
    Uniprot P14123
  8. 2887602Domain d1yijn1: 1yij N:1-186 [123311]
    Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1ffkk_
    complexed with cd, cl, k, mg, na, tel; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d1yijn1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1yijn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijn1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d1yijn1:

Click to download the PDB-style file with coordinates for d1yijn1.
(The format of our PDB-style files is described here.)

Timeline for d1yijn1: