SCOPe 2.08: Domain d1yijx1: 1yij X:7-88

Lineage for d1yijx1 (1yij X:7-88)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)
   automatically mapped to Pfam PF01198

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
   Uniprot P18138

8. Domain d1yijx1: 1yij X:7-88 [123321]
   Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijy1, d1yijz1
   automatically matched to d1ffku_
   complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijx1

PDB Entry: 1yij, 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1yijx1:

Sequence; same for both SEQRES and ATOM records:

>d1yijx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1yijx1:

• d1yijx1 first appeared in SCOP 1.73
  
• d1yijx1 appears in SCOPe 2.07