Lineage for d1yijg1 (1yij G:12-73)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047153Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 3047154Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 3047155Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 3047156Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 3047157Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 3047178Domain d1yijg1: 1yij G:12-73 [144643]
    Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to 1VQ4 G:12-73
    complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijg1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1yijg1:

Sequence, based on SEQRES records: (download)

>d1yijg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1yijg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1yijg1:

Click to download the PDB-style file with coordinates for d1yijg1.
(The format of our PDB-style files is described here.)

Timeline for d1yijg1: