SCOPe 2.05: Domain d1yigb_: 1yig B:

Lineage for d1yigb_ (1yig B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d1yigb_: 1yig B: [123292]
   automated match to d1yiga1

Details for d1yigb_

PDB Entry: 1yig, 2 Å

PDB Description: crystal structure of the human eb1 c-terminal dimerization domain

PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1yigb_:

Sequence; same for both SEQRES and ATOM records:

>d1yigb_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
d

Timeline for d1yigb_:

• d1yigb_ first appeared in SCOP 1.73, called d1yigb1
  
• d1yigb_ appears in SCOPe 2.04
  
• d1yigb_ appears in SCOPe 2.06
  
• d1yigb_ appears in the current release, SCOPe 2.08