Lineage for d1yigb1 (1yig B:190-250)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651661Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 651662Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 651663Family a.245.1.1: EB1 dimerisation domain-like [140613] (1 protein)
    Pfam PF03271
  6. 651664Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 651665Species Human (Homo sapiens) [TaxId:9606] [140615] (6 PDB entries)
  8. 651672Domain d1yigb1: 1yig B:190-250 [123292]
    automatically matched to 1YIG A:190-255
    mutant

Details for d1yigb1

PDB Entry: 1yig (more details), 2 Å

PDB Description: crystal structure of the human eb1 c-terminal dimerization domain
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOP Domain Sequences for d1yigb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yigb1 a.245.1.1 (B:190-250) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
d

SCOP Domain Coordinates for d1yigb1:

Click to download the PDB-style file with coordinates for d1yigb1.
(The format of our PDB-style files is described here.)

Timeline for d1yigb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yiga1