Lineage for d1ygoa2 (1ygo A:5-110)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001582Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2001583Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2001584Family a.77.1.2: DEATH domain, DD [81312] (9 protein domains)
    Pfam PF00531
  6. 2001617Protein Pelle death domain [48003] (1 species)
  7. 2001618Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48004] (3 PDB entries)
  8. 2001623Domain d1ygoa2: 1ygo A:5-110 [123146]
    Other proteins in same PDB: d1ygoa3
    automated match to d1d2zc_

Details for d1ygoa2

PDB Entry: 1ygo (more details)

PDB Description: Solution Structure of the pelle Death Domain
PDB Compounds: (A:) PROBABLE SERINE/THREONINE-PROTEIN KINASE Pelle

SCOPe Domain Sequences for d1ygoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygoa2 a.77.1.2 (A:5-110) Pelle death domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrsasne
flniwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyipr

SCOPe Domain Coordinates for d1ygoa2:

Click to download the PDB-style file with coordinates for d1ygoa2.
(The format of our PDB-style files is described here.)

Timeline for d1ygoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ygoa3