| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
| Protein Pelle death domain [48003] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48004] (3 PDB entries) |
| Domain d1ygoa2: 1ygo A:5-110 [123146] Other proteins in same PDB: d1ygoa3 automated match to d1d2zc_ |
PDB Entry: 1ygo (more details)
SCOPe Domain Sequences for d1ygoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygoa2 a.77.1.2 (A:5-110) Pelle death domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrsasne
flniwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyipr
Timeline for d1ygoa2: