PDB entry 1ygo

View 1ygo on RCSB PDB site
Description: Solution Structure of the pelle Death Domain
Class: transferase
Keywords: anti-parallel 6 helix bundle, TRANSFERASE
Deposited on 2005-01-05, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROBABLE SERINE/THREONINE-PROTEIN KINASE Pelle
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: pll
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05652 (4-109)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1ygoa2, d1ygoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ygoA (A:)
    gshmshldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrs
    asneflniwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyipr