Lineage for d1yg6a_ (1yg6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852709Species Escherichia coli [TaxId:562] [186874] (4 PDB entries)
  8. 2852710Domain d1yg6a_: 1yg6 A: [123100]
    automated match to d1tyfa_
    complexed with mpd

Details for d1yg6a_

PDB Entry: 1yg6 (more details), 1.9 Å

PDB Description: clpp
PDB Compounds: (A:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d1yg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yg6a_ c.14.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilthrn

SCOPe Domain Coordinates for d1yg6a_:

Click to download the PDB-style file with coordinates for d1yg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1yg6a_: