Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Escherichia coli [TaxId:562] [186874] (4 PDB entries) |
Domain d1yg6a_: 1yg6 A: [123100] automated match to d1tyfa_ complexed with mpd |
PDB Entry: 1yg6 (more details), 1.9 Å
SCOPe Domain Sequences for d1yg6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yg6a_ c.14.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav eyglvdsilthrn
Timeline for d1yg6a_: