![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein automated matches [190149] (14 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186874] (4 PDB entries) |
![]() | Domain d1yg6h_: 1yg6 H: [123107] automated match to d1tyfa_ complexed with mpd |
PDB Entry: 1yg6 (more details), 1.9 Å
SCOPe Domain Sequences for d1yg6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yg6h_ c.14.1.1 (H:) automated matches {Escherichia coli [TaxId: 562]} eqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspg gvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplgg yqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvds ilthrn
Timeline for d1yg6h_: