PDB entry 1yg6

View 1yg6 on RCSB PDB site
Description: ClpP
Class: hydrolase
Keywords: Endopeptidase Clp, Caseinolytic protease, Protease Ti, Heat shock protein F21.5, HYDROLASE
Deposited on 2005-01-04, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yg6n_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yg6A (A:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yg6B (B:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6B (B:)
    lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
    yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
    hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
    yglvdsilthrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yg6C (C:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6C (C:)
    mvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyin
    spggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqp
    lggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveygl
    vdsilthrn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yg6D (D:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yg6E (E:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yg6F (F:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yg6G (G:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6G (G:)
    lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
    yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
    hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
    yglvdsilthrn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yg6H (H:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6H (H:)
    eqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspg
    gvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplgg
    yqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvds
    ilthrn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yg6I (I:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6I (I:)
    tsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggv
    itagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyq
    gqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsil
    thrn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yg6J (J:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6J (J:)
    tsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggv
    itagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyq
    gqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsil
    thrn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1yg6K (K:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6K (K:)
    sfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagms
    iydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatdi
    eihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1yg6L (L:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6L (L:)
    rgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvit
    agmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgq
    atdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilth
    rn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1yg6M (M:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6M (M:)
    rgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvit
    agmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgq
    atdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilth
    rn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1yg6N (N:)
    alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg6N (N:)
    fdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagmsi
    ydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatdie
    ihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn