SCOPe 2.06: Domain d1yfta1: 1yft A:237-453

Lineage for d1yfta1 (1yft A:237-453)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family)

5. Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)

6. Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [101356] (6 PDB entries)

8. Domain d1yfta1: 1yft A:237-453 [123092]
   Other proteins in same PDB: d1yfta2, d1yfta3
   automated match to d1riqa1
   protein/RNA complex; complexed with gly

Details for d1yfta1

PDB Entry: 1yft, 2.23 Å

PDB Description: The crystal structure of the catalytic fragment of alanyl-tRNA synthetase in complex wtih glycine

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfta1:

Sequence, based on SEQRES records:

>d1yfta1 a.203.1.1 (A:237-453) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvg

Sequence, based on observed residues (ATOM records):

>d1yfta1 a.203.1.1 (A:237-453) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhpvyshlkelgktsafvg

Timeline for d1yfta1:

• d1yfta1 first appeared in SCOP 1.73
  
• d1yfta1 appears in SCOPe 2.05
  
• d1yfta1 appears in SCOPe 2.07
  
• d1yfta1 appears in the current release, SCOPe 2.08