Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries) |
Domain d1yfra2: 1yfr A:1-236 [123085] Other proteins in same PDB: d1yfra1, d1yfra3, d1yfrb1, d1yfrb3 automated match to d1riqa2 protein/RNA complex; complexed with atp, mg |
PDB Entry: 1yfr (more details), 2.15 Å
SCOPe Domain Sequences for d1yfra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfra2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf
Timeline for d1yfra2: