SCOP 1.73: Domain d1yfra2: 1yfr A:1-236

Lineage for d1yfra2 (1yfr A:1-236)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [103156] (5 PDB entries)

8. Domain d1yfra2: 1yfr A:1-236 [123085]
   Other proteins in same PDB: d1yfra1, d1yfrb1
   automatically matched to d1riqa2
   complexed with atp, mg

Details for d1yfra2

PDB Entry: 1yfr, 2.15 Å

PDB Description: crystal structure of alanyl-trna synthetase in complex with atp and magnesium

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOP Domain Sequences for d1yfra2:

Sequence; same for both SEQRES and ATOM records:

>d1yfra2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

Timeline for d1yfra2:

• d1yfra2 is new in SCOP 1.73
  
• d1yfra2 appears in SCOP 1.75
  
• d1yfra2 appears in the current release, SCOPe 2.08