Lineage for d1ydyb1 (1ydy B:29-356)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818986Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 819029Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (4 proteins)
    Pfam PF03009
  6. 819030Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)
  7. 819031Species Escherichia coli [TaxId:562] [110383] (2 PDB entries)
    Uniprot P09394
  8. 819033Domain d1ydyb1: 1ydy B:29-356 [123007]
    automatically matched to d1t8qb_
    complexed with ca, gol

Details for d1ydyb1

PDB Entry: 1ydy (more details), 1.7 Å

PDB Description: crystal structure of periplasmic glycerophosphodiester phosphodiesterase from escherichia coli
PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase

SCOP Domain Sequences for d1ydyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydyb1 c.1.18.3 (B:29-356) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]}
nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
qlydalynkagvnglftdfpdkavkfln

SCOP Domain Coordinates for d1ydyb1:

Click to download the PDB-style file with coordinates for d1ydyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ydyb1: