SCOPe 2.02: Domain d1yd9c_: 1yd9 C:

Lineage for d1yd9c_ (1yd9 C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (3 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186871] (1 PDB entry)

8. Domain d1yd9c_: 1yd9 C: [122978]
   Other proteins in same PDB: d1yd9a1
   automated match to d1spva_
   complexed with au

Details for d1yd9c_

PDB Entry: 1yd9, 1.6 Å

PDB Description: 1.6A Crystal Structure of the Non-Histone Domain of the Histone Variant MacroH2A1.1.

PDB Compounds: (C:) Core histone macro-H2A.1

SCOPe Domain Sequences for d1yd9c_:

Sequence; same for both SEQRES and ATOM records:

>d1yd9c_ c.50.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgstlekkggkefve
avlelrkkngplevagaavsaghglpakfvihcnspvwgsdkceellektvknclaladd
rklksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyv
qemakld

Timeline for d1yd9c_:

• d1yd9c_ first appeared in SCOP 1.73, called d1yd9c1
  
• d1yd9c_ appears in SCOPe 2.01
  
• d1yd9c_ appears in SCOPe 2.03
  
• d1yd9c_ appears in the current release, SCOPe 2.08, called d1yd9c2