SCOPe 2.08: Domain d1yd9c2: 1yd9 C:6-191

Lineage for d1yd9c2 (1yd9 C:6-191)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186871] (1 PDB entry)

8. Domain d1yd9c2: 1yd9 C:6-191 [122978]
   Other proteins in same PDB: d1yd9a1, d1yd9c3
   automated match to d1spva_
   complexed with au

Details for d1yd9c2

PDB Entry: 1yd9, 1.6 Å

PDB Description: 1.6A Crystal Structure of the Non-Histone Domain of the Histone Variant MacroH2A1.1.

PDB Compounds: (C:) Core histone macro-H2A.1

SCOPe Domain Sequences for d1yd9c2:

Sequence; same for both SEQRES and ATOM records:

>d1yd9c2 c.50.1.0 (C:6-191) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgstlekkggkefvea
vlelrkkngplevagaavsaghglpakfvihcnspvwgsdkceellektvknclaladdr
klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
emakld

Timeline for d1yd9c2:

• d1yd9c2 first appeared in SCOP 1.73, called d1yd9c1
  
• d1yd9c2 appears in SCOPe 2.07