| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
| Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins) |
| Protein Nitric oxide reductase N-terminal domain [143914] (2 species) |
| Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries) Uniprot Q9FDN7 2-250 |
| Domain d1ychb2: 1ych B:2-250 [122960] Other proteins in same PDB: d1ycha1, d1ychb1, d1ychc1, d1ychd1 automated match to d1ycfa2 complexed with feo, fmn, zn |
PDB Entry: 1ych (more details), 2.8 Å
SCOPe Domain Sequences for d1ychb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ychb2 d.157.1.3 (B:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq
Timeline for d1ychb2: