Lineage for d1ychb2 (1ych B:2-250)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736712Family d.157.1.3: ROO N-terminal domain-like [56291] (3 proteins)
  6. 736713Protein Nitric oxide reductase N-terminal domain [143914] (1 species)
  7. 736714Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries)
  8. 736724Domain d1ychb2: 1ych B:2-250 [122960]
    Other proteins in same PDB: d1ycha1, d1ychb1, d1ychc1, d1ychd1
    automatically matched to 1YCF A:2-250
    complexed with feo, fmn, zn

Details for d1ychb2

PDB Entry: 1ych (more details), 2.8 Å

PDB Description: x-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
PDB Compounds: (B:) Nitric oxide reductase

SCOP Domain Sequences for d1ychb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ychb2 d.157.1.3 (B:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

SCOP Domain Coordinates for d1ychb2:

Click to download the PDB-style file with coordinates for d1ychb2.
(The format of our PDB-style files is described here.)

Timeline for d1ychb2: