Lineage for d1ycfb1 (1ycf B:251-399)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587788Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1587789Protein automated matches [190158] (17 species)
    not a true protein
  7. Species Moorella thermoacetica [TaxId:1525] [254979] (1 PDB entry)
  8. 1587864Domain d1ycfb1: 1ycf B:251-399 [122943]
    Other proteins in same PDB: d1ycfa1, d1ycfa2, d1ycfb2, d1ycfc2, d1ycfd2
    automated match to d1ycga1
    complexed with feo, fmn, oxy, zn

Details for d1ycfb1

PDB Entry: 1ycf (more details), 3 Å

PDB Description: oxidized (di-ferric) fpra from moorella thermoacetica
PDB Compounds: (B:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycfb1 c.23.5.0 (B:251-399) automated matches {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

SCOPe Domain Coordinates for d1ycfb1:

Click to download the PDB-style file with coordinates for d1ycfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ycfb1: