SCOPe 2.04: Domain d1ycfc2: 1ycf C:2-250

Lineage for d1ycfc2 (1ycf C:2-250)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)

6. Protein automated matches [227097] (2 species)
   not a true protein

7. Species Moorella thermoacetica [TaxId:1525] [254978] (1 PDB entry)

8. Domain d1ycfc2: 1ycf C:2-250 [122946]
   Other proteins in same PDB: d1ycfa1, d1ycfa2, d1ycfb1, d1ycfc1, d1ycfd1
   automated match to d1ycga2
   complexed with feo, fmn, oxy, zn

Details for d1ycfc2

PDB Entry: 1ycf, 3 Å

PDB Description: oxidized (di-ferric) fpra from moorella thermoacetica

PDB Compounds: (C:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycfc2:

Sequence; same for both SEQRES and ATOM records:

>d1ycfc2 d.157.1.3 (C:2-250) automated matches {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

Timeline for d1ycfc2:

• d1ycfc2 first appeared in SCOP 1.73
  
• d1ycfc2 appears in SCOPe 2.03
  
• d1ycfc2 appears in SCOPe 2.05
  
• d1ycfc2 appears in the current release, SCOPe 2.08