Lineage for d1yc6f1 (1yc6 F:36-189)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141867Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 1141868Protein Cucumovirus coat protein [88640] (4 species)
  7. 1141869Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (2 PDB entries)
  8. 1141879Domain d1yc6f1: 1yc6 F:36-189 [122920]
    automatically matched to d1js9b_

Details for d1yc6f1

PDB Entry: 1yc6 (more details), 2.9 Å

PDB Description: Crystallographic Structure of the T=1 Particle of Brome Mosaic Virus
PDB Compounds: (F:) coat protein

SCOPe Domain Sequences for d1yc6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yc6f1 b.121.4.5 (F:36-189) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
lyaseavpakavvvhlevehvrptfddfftpvyr

SCOPe Domain Coordinates for d1yc6f1:

Click to download the PDB-style file with coordinates for d1yc6f1.
(The format of our PDB-style files is described here.)

Timeline for d1yc6f1: