Lineage for d1ybmb_ (1ybm B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577580Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species)
  7. 1577581Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries)
    Uniprot Q94EG6
  8. 1577589Domain d1ybmb_: 1ybm B: [122896]
    automated match to d1xq6a_
    complexed with nap

Details for d1ybmb_

PDB Entry: 1ybm (more details), 2.1 Å

PDB Description: x-ray structure of selenomethionyl gene product from arabidopsis thaliana at5g02240 in space group p21212
PDB Compounds: (B:) unknown protein At5g02240

SCOPe Domain Sequences for d1ybmb_:

Sequence, based on SEQRES records: (download)

>d1ybmb_ c.2.1.2 (B:) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
dfkalfsqvtsrf

Sequence, based on observed residues (ATOM records): (download)

>d1ybmb_ c.2.1.2 (B:) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
dsinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivv
vgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvg
kddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvt
srf

SCOPe Domain Coordinates for d1ybmb_:

Click to download the PDB-style file with coordinates for d1ybmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ybmb_: