![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries) Uniprot Q94EG6 |
![]() | Domain d1ybmb2: 1ybm B:2-253 [122896] Other proteins in same PDB: d1ybma2, d1ybmb3 automated match to d1xq6a_ complexed with nap |
PDB Entry: 1ybm (more details), 2.1 Å
SCOPe Domain Sequences for d1ybmb2:
Sequence, based on SEQRES records: (download)
>d1ybmb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad sinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaak vagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldke ggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkd fkalfsqvtsrf
>d1ybmb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad sinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivvv gsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgk ddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvts rf
Timeline for d1ybmb2: