Lineage for d1ya7f_ (1ya7 F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1046004Species Thermoplasma acidophilum [TaxId:2303] [186869] (5 PDB entries)
  8. 1046024Domain d1ya7f_: 1ya7 F: [122795]
    Other proteins in same PDB: d1ya7o1, d1ya7p_, d1ya7q_, d1ya7r_, d1ya7s_, d1ya7t_, d1ya7u_
    automated match to d1pmaa_
    complexed with gol, so4

Details for d1ya7f_

PDB Entry: 1ya7 (more details), 2.3 Å

PDB Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex
PDB Compounds: (F:) Proteasome alpha subunit

SCOPe Domain Sequences for d1ya7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ya7f_ d.153.1.4 (F:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d1ya7f_:

Click to download the PDB-style file with coordinates for d1ya7f_.
(The format of our PDB-style files is described here.)

Timeline for d1ya7f_: