![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Probable acetyltransferase BC2806 [143650] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [143651] (1 PDB entry) Uniprot Q81CG1 1-140 |
![]() | Domain d1y9wb_: 1y9w B: [122784] automated match to d1y9wa1 |
PDB Entry: 1y9w (more details), 1.9 Å
SCOPe Domain Sequences for d1y9wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9wb_ d.108.1.1 (B:) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} mymkhiengtriegeyiknkviqynmsiltdevkqpmeevslvvkneegkifggvtgtmy fyhlhidflwvdesvrhdgygsqllheiegiakekgcrlilldsfsfqapefykkhgyre ygvvedhpkghsqhffekrl
Timeline for d1y9wb_: