Lineage for d1y9wb1 (1y9w B:1-140)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731209Protein Probable acetyltransferase BC2806 [143650] (1 species)
  7. 731210Species Bacillus cereus [TaxId:1396] [143651] (1 PDB entry)
  8. 731212Domain d1y9wb1: 1y9w B:1-140 [122784]
    automatically matched to 1Y9W A:1-140

Details for d1y9wb1

PDB Entry: 1y9w (more details), 1.9 Å

PDB Description: Structural Genomics, 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (B:) Acetyltransferase

SCOP Domain Sequences for d1y9wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9wb1 d.108.1.1 (B:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}
mymkhiengtriegeyiknkviqynmsiltdevkqpmeevslvvkneegkifggvtgtmy
fyhlhidflwvdesvrhdgygsqllheiegiakekgcrlilldsfsfqapefykkhgyre
ygvvedhpkghsqhffekrl

SCOP Domain Coordinates for d1y9wb1:

Click to download the PDB-style file with coordinates for d1y9wb1.
(The format of our PDB-style files is described here.)

Timeline for d1y9wb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y9wa1