Lineage for d1y8pb1 (1y8p B:128-229)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810795Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 810796Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 810808Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 810817Species Human (Homo sapiens) [TaxId:9606] [51242] (4 PDB entries)
  8. 810819Domain d1y8pb1: 1y8p B:128-229 [122760]
    Other proteins in same PDB: d1y8pa1, d1y8pa2
    automatically matched to d1fyc__
    complexed with atp, k, lpa, mg

Details for d1y8pb1

PDB Entry: 1y8p (more details), 2.63 Å

PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (B:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOP Domain Sequences for d1y8pb1:

Sequence, based on SEQRES records: (download)

>d1y8pb1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadyrptevtdlk

Sequence, based on observed residues (ATOM records): (download)

>d1y8pb1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadytdlk

SCOP Domain Coordinates for d1y8pb1:

Click to download the PDB-style file with coordinates for d1y8pb1.
(The format of our PDB-style files is described here.)

Timeline for d1y8pb1: