SCOPe 2.08: Domain d1y8pb_: 1y8p B:

Lineage for d1y8pb_ (1y8p B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
   component of the pyruvate dehydrogenase complex

7. Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)

8. Domain d1y8pb_: 1y8p B: [122760]
   Other proteins in same PDB: d1y8pa1, d1y8pa3
   automated match to d1fyca_
   complexed with atp, k, mg, red

Details for d1y8pb_

PDB Entry: 1y8p, 2.63 Å

PDB Description: Crystal structure of the PDK3-L2 complex

PDB Compounds: (B:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d1y8pb_:

Sequence, based on SEQRES records:

>d1y8pb_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadyrptevtdlk

Sequence, based on observed residues (ATOM records):

>d1y8pb_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadytdlk

Timeline for d1y8pb_:

• d1y8pb_ first appeared in SCOP 1.73, called d1y8pb1
  
• d1y8pb_ appears in SCOPe 2.07