Class g: Small proteins [56992] (85 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
Protein Complement control protein [57539] (1 species) |
Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries) a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans |
Domain d1y8eb1: 1y8e B:2-64 [122740] automatically matched to d1g40a1 complexed with svr |
PDB Entry: 1y8e (more details), 2.2 Å
SCOP Domain Sequences for d1y8eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8eb1 g.18.1.1 (B:2-64) Complement control protein {Vaccinia virus [TaxId: 10245]} ctipsrpinmkfknsvetdananynigdtieylclpgyrkqkmgpiyakctgtgwtlfnq cik
Timeline for d1y8eb1:
View in 3D Domains from other chains: (mouse over for more information) d1y8ea1, d1y8ea2, d1y8ea3, d1y8ea4 |