Lineage for d1y8eb3 (1y8e B:127-184)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749339Protein Complement control protein [57539] (1 species)
  7. 749340Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries)
    a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans
  8. 749355Domain d1y8eb3: 1y8e B:127-184 [122742]
    automatically matched to d1e5ga2
    complexed with svr

Details for d1y8eb3

PDB Entry: 1y8e (more details), 2.2 Å

PDB Description: vcp:suramin complex
PDB Compounds: (B:) complement control protein

SCOP Domain Sequences for d1y8eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8eb3 g.18.1.1 (B:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]}
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi

SCOP Domain Coordinates for d1y8eb3:

Click to download the PDB-style file with coordinates for d1y8eb3.
(The format of our PDB-style files is described here.)

Timeline for d1y8eb3: