SCOPe 2.07: Domain d1y7tb1: 1y7t B:0-153

Lineage for d1y7tb1 (1y7t B:0-153)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1y7tb1: 1y7t B:0-153 [122720]
   Other proteins in same PDB: d1y7ta2, d1y7tb2
   automated match to d1iz9a1
   complexed with ndp, trs

Details for d1y7tb1

PDB Entry: 1y7t, 1.65 Å

PDB Description: Crystal structure of NAD(H)-depenent malate dehydrogenase complexed with NADPH

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1y7tb1:

Sequence; same for both SEQRES and ATOM records:

>d1y7tb1 c.2.1.5 (B:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

Timeline for d1y7tb1:

• d1y7tb1 first appeared in SCOP 1.73
  
• d1y7tb1 appears in SCOPe 2.06
  
• d1y7tb1 appears in the current release, SCOPe 2.08