SCOP 1.73: Domain d1y7mb1: 1y7m B:49-164

Lineage for d1y7mb1 (1y7m B:49-164)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family)

5. Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (2 proteins)
   Pfam PF03734; ErfK/YbiS/YcfS/YnhG

6. Protein Hypothetical protein YkuD, C-terminal domain [141527] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141528] (1 PDB entry)

8. Domain d1y7mb1: 1y7m B:49-164 [122698]
   Other proteins in same PDB: d1y7ma2, d1y7mb2
   automatically matched to 1Y7M A:49-164
   complexed with cd, so4; mutant

Details for d1y7mb1

PDB Entry: 1y7m, 2.05 Å

PDB Description: crystal structure of the b. subtilis ykud protein at 2 a resolution

PDB Compounds: (B:) hypothetical protein BSU14040

SCOP Domain Sequences for d1y7mb1:

Sequence; same for both SEQRES and ATOM records:

>d1y7mb1 b.160.1.1 (B:49-164) Hypothetical protein YkuD, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslsaahygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr

Timeline for d1y7mb1:

• d1y7mb1 is new in SCOP 1.73
  
• d1y7mb1 appears in SCOP 1.75
  
• d1y7mb1 appears in the current release, SCOPe 2.08