PDB entry 1y7m

View 1y7m on RCSB PDB site
Description: Crystal Structure of the B. subtilis YkuD protein at 2 A resolution
Class: structural genomics, unknown function
Keywords: surface mutagenesis, cysteine proteases, cell wall catabolism, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-12-09, released 2005-03-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein BSU14040
  Species: Bacillus subtilis subsp. subtilis str. 168
  Gene: ykud
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34816 (0-163)
    • modified residue (0)
    • modified residue (75)
    • engineered (116-117)
    • modified residue (141)
  Domains in SCOP 1.73: d1y7ma1, d1y7ma2
• Chain 'B':
  Compound: hypothetical protein BSU14040
  Species: Bacillus subtilis subsp. subtilis str. 168
  Gene: ykud
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34816 (0-163)
    • modified residue (0)
    • modified residue (75)
    • engineered (116-117)
    • modified residue (141)
  Domains in SCOP 1.73: d1y7mb1, d1y7mb2
• Heterogens: CD, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y7mA (A:)
  mltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyhiav
  sigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsaahy
  gihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y7mB (B:)
  mltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyhiav
  sigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsaahy
  gihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr