Lineage for d1y7ma1 (1y7m A:49-164)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 681000Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 681001Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
  5. 681002Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (2 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 681003Protein Hypothetical protein YkuD, C-terminal domain [141527] (1 species)
  7. 681004Species Bacillus subtilis [TaxId:1423] [141528] (1 PDB entry)
  8. 681005Domain d1y7ma1: 1y7m A:49-164 [122696]
    Other proteins in same PDB: d1y7ma2, d1y7mb2
    complexed with cd, so4; mutant

Details for d1y7ma1

PDB Entry: 1y7m (more details), 2.05 Å

PDB Description: crystal structure of the b. subtilis ykud protein at 2 a resolution
PDB Compounds: (A:) hypothetical protein BSU14040

SCOP Domain Sequences for d1y7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ma1 b.160.1.1 (A:49-164) Hypothetical protein YkuD, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslsaahygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr

SCOP Domain Coordinates for d1y7ma1:

Click to download the PDB-style file with coordinates for d1y7ma1.
(The format of our PDB-style files is described here.)

Timeline for d1y7ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y7ma2