Lineage for d1y6qb_ (1y6q B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495717Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)
  7. 2495718Species Escherichia coli [TaxId:562] [82449] (8 PDB entries)
  8. 2495733Domain d1y6qb_: 1y6q B: [122671]
    Other proteins in same PDB: d1y6qa3
    automated match to d1nc3a_
    complexed with cl, tdi

Details for d1y6qb_

PDB Entry: 1y6q (more details), 2.2 Å

PDB Description: Cyrstal structure of MTA/AdoHcy nucleosidase complexed with MT-DADMe-ImmA
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d1y6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6qb_ c.56.2.1 (B:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOPe Domain Coordinates for d1y6qb_:

Click to download the PDB-style file with coordinates for d1y6qb_.
(The format of our PDB-style files is described here.)

Timeline for d1y6qb_: