SCOP 1.73: Domain d1y6qb1: 1y6q B:1-232

Lineage for d1y6qb1 (1y6q B:1-232)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (1 species)

7. Species Escherichia coli [TaxId:562] [82449] (6 PDB entries)

8. Domain d1y6qb1: 1y6q B:1-232 [122671]
   automatically matched to d1nc3a_
   complexed with cl, tdi

Details for d1y6qb1

PDB Entry: 1y6q, 2.2 Å

PDB Description: Cyrstal structure of MTA/AdoHcy nucleosidase complexed with MT-DADMe-ImmA

PDB Compounds: (B:) MTA/SAH nucleosidase

SCOP Domain Sequences for d1y6qb1:

Sequence; same for both SEQRES and ATOM records:

>d1y6qb1 c.56.2.1 (B:1-232) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

Timeline for d1y6qb1:

• d1y6qb1 is new in SCOP 1.73
  
• d1y6qb1 appears in SCOP 1.75
  
• d1y6qb1 appears in the current release, SCOPe 2.08, called d1y6qb_