SCOPe 2.02: Domain d1y6ia1: 1y6i A:1-82

Lineage for d1y6ia1 (1y6i A:1-82)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
   PfamB PB089177
   this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain

6. Protein Mg-chelatase cofactor Gun4 [140826] (1 species)
   Ycf53-like protein sll0558

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [140827] (1 PDB entry)
   Uniprot P72583 1-82

8. Domain d1y6ia1: 1y6i A:1-82 [122660]
   Other proteins in same PDB: d1y6ia2

Details for d1y6ia1

PDB Entry: 1y6i, 1.78 Å

PDB Description: synechocystis gun4

PDB Compounds: (A:) Mg-chelatase cofactor GUN4

SCOPe Domain Sequences for d1y6ia1:

Sequence; same for both SEQRES and ATOM records:

>d1y6ia1 a.118.1.22 (A:1-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
msdnltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyq
tlrnleqetittqlqrnyptgi

Timeline for d1y6ia1:

• d1y6ia1 first appeared in SCOP 1.73
  
• d1y6ia1 appears in SCOPe 2.01
  
• d1y6ia1 appears in SCOPe 2.03
  
• d1y6ia1 appears in the current release, SCOPe 2.08