Lineage for d1y6ia1 (1y6i A:1-82)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006847Family a.118.1.22: GUN4-associated domain [140825] (2 protein domains)
    PfamB PB089177
  6. 2006852Protein Mg-chelatase cofactor Gun4 [140826] (2 species)
    Ycf53-like protein sll0558
  7. 2006853Species Synechocystis sp. PCC 6803 [TaxId:1148] [140827] (1 PDB entry)
    Uniprot P72583 1-82
  8. 2006854Domain d1y6ia1: 1y6i A:1-82 [122660]
    Other proteins in same PDB: d1y6ia2

Details for d1y6ia1

PDB Entry: 1y6i (more details), 1.78 Å

PDB Description: Synechocystis GUN4
PDB Compounds: (A:) Mg-chelatase cofactor GUN4

SCOPe Domain Sequences for d1y6ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6ia1 a.118.1.22 (A:1-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
msdnltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyq
tlrnleqetittqlqrnyptgi

SCOPe Domain Coordinates for d1y6ia1:

Click to download the PDB-style file with coordinates for d1y6ia1.
(The format of our PDB-style files is described here.)

Timeline for d1y6ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6ia2