SCOPe 2.05: Domain d1y4hb_: 1y4h B:

Lineage for d1y4hb_ (1y4h B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Staphopain SspB [102721] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
   Uniprot Q70UQ9 41-393

8. Domain d1y4hb_: 1y4h B: [122616]
   Other proteins in same PDB: d1y4hc_, d1y4hd_
   automated match to d1pxva_
   complexed with cl, so4

Details for d1y4hb_

PDB Entry: 1y4h, 1.93 Å

PDB Description: wild type staphopain-staphostatin complex

PDB Compounds: (B:) Cysteine protease

SCOPe Domain Sequences for d1y4hb_:

Sequence; same for both SEQRES and ATOM records:

>d1y4hb_ d.3.1.1 (B:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
qvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlp
ncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlgh
alavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy

Timeline for d1y4hb_:

• d1y4hb_ first appeared in SCOP 1.73, called d1y4hb1
  
• d1y4hb_ appears in SCOPe 2.04
  
• d1y4hb_ appears in SCOPe 2.06
  
• d1y4hb_ appears in the current release, SCOPe 2.08