SCOP 1.73: Domain d1y4hb1: 1y4h B:221-393

Lineage for d1y4hb1 (1y4h B:221-393)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein Staphopain SspB [102721] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)

8. Domain d1y4hb1: 1y4h B:221-393 [122616]
   Other proteins in same PDB: d1y4hc1, d1y4hd1
   automatically matched to 1Y4H A:221-393
   complexed with cl, so4

Details for d1y4hb1

PDB Entry: 1y4h, 1.93 Å

PDB Description: wild type staphopain-staphostatin complex

PDB Compounds: (B:) Cysteine protease

SCOP Domain Sequences for d1y4hb1:

Sequence; same for both SEQRES and ATOM records:

>d1y4hb1 d.3.1.1 (B:221-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
qvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlp
ncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlgh
alavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy

Timeline for d1y4hb1:

• d1y4hb1 is new in SCOP 1.73
  
• d1y4hb1 appears in SCOP 1.75
  
• d1y4hb1 appears in the current release, SCOPe 2.08, called d1y4hb_