SCOPe 2.01: Domain d1y3aa1: 1y3a A:61-181

Lineage for d1y3aa1 (1y3a A:61-181)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)

8. Domain d1y3aa1: 1y3a A:61-181 [122582]
   Other proteins in same PDB: d1y3aa2, d1y3ab2, d1y3ac2, d1y3ad2
   automatically matched to d1kjya1
   complexed with gdp

Details for d1y3aa1

PDB Entry: 1y3a, 2.5 Å

PDB Description: structure of g-alpha-i1 bound to a gdp-selective peptide provides insight into guanine nucleotide exchange

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1y3aa1:

Sequence, based on SEQRES records:

>d1y3aa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records):

>d1y3aa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

Timeline for d1y3aa1:

• d1y3aa1 first appeared in SCOP 1.73
  
• d1y3aa1 appears in SCOP 1.75
  
• d1y3aa1 appears in SCOPe 2.02
  
• d1y3aa1 appears in the current release, SCOPe 2.08